PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00010.371
Common NameAMTR_s00010p00253290, LOC18422423
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family HD-ZIP
Protein Properties Length: 298aa    MW: 33354.5 Da    PI: 5.7049
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00010.371genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox566.8e-1880133356
                                               --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                                  Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                               k+++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rq+ +WFqNrRa++k
  evm_27.model.AmTr_v1.0_scaffold00010.371  80 KKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWK 133
                                               456899***********************************************9 PP

2HD-ZIP_I/II126.89.6e-4179169191
                               HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkra 69 
                                               ekkrrl+ eqvk+LE++Fe  +kLeperK++lar+Lglqprq+a+WFqnrRAR+ktkqlEkdy+ Lkr+
  evm_27.model.AmTr_v1.0_scaffold00010.371  79 EKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWKTKQLEKDYDLLKRQ 147
                                               69******************************************************************* PP

                               HD-ZIP_I/II  70 ydalkeenerLekeveeLreel 91 
                                               ++a+k++ne L++++++L++e+
  evm_27.model.AmTr_v1.0_scaffold00010.371 148 FEAVKADNELLQAQNKKLQAEI 169
                                               *******************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-1970137IPR009057Homeodomain-like
PROSITE profilePS5007117.32975135IPR001356Homeobox domain
SMARTSM003891.8E-1778139IPR001356Homeobox domain
CDDcd000861.41E-1680136No hitNo description
PfamPF000463.0E-1580133IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.0E-1982142IPR009057Homeodomain-like
PRINTSPR000311.2E-5106115IPR000047Helix-turn-helix motif
PROSITE patternPS000270110133IPR017970Homeobox, conserved site
PRINTSPR000311.2E-5115131IPR000047Helix-turn-helix motif
PfamPF021833.8E-12135174IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009744Biological Processresponse to sucrose
GO:0048826Biological Processcotyledon morphogenesis
GO:0080022Biological Processprimary root development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MGCNAMAFFP SNFMLQSNGD NDQAPNAAIS SIVSSCTPQD FHGMASMMGK RSMSFSGLEI  60
CEEMNCEDDL SDDCSQAGEK KRRLNMEQVK TLEKNFELGN KLEPERKMQL ARALGLQPRQ  120
IAIWFQNRRA RWKTKQLEKD YDLLKRQFEA VKADNELLQA QNKKLQAEIL ALKKSKESEP  180
INLNKENTEG SCSIKSENSS DLNLDISKPI TTESPISPNS QRNFFHSMRP ANVTSHLLHG  240
SSRLELQCPK LVGNSGNGSM DEGSSGAQEE PFLNMFCPID ESSAFWPWTD HCTSSFH*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1127135RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00225DAPTransfer from AT1G69780Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006827158.10.0PREDICTED: homeobox-leucine zipper protein ATHB-13
SwissprotQ8LC031e-99ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLW1NGU80.0W1NGU8_AMBTC; Uncharacterized protein
STRINGVIT_01s0026g01950.t011e-131(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12916189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.11e-101HD-ZIP family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]